If you have been reading about Mass spectrometry and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-03-02. Numbers and descriptions here follow the published literature rather than marketing material.
Once dissolved, the material is considerably less stable than the dry solid. Aqueous solutions are usually kept cold and used within a short window, and neutral or mildly acidic buffers are preferred over strongly alkaline conditions. Freeze-thaw cycles promote aggregation and loss of material to container surfaces, so dividing a batch into single-use aliquots is standard. Adsorption to plastic and glass can lower the measured concentration, meaning solution strength may need rechecking before an experiment.
Identity and purity are established with complementary methods rather than one test. Reverse-phase high-performance liquid chromatography separates the main peak from deletion sequences and oxidized variants, and its area percentage is the usual purity figure. Mass spectrometry confirms the expected molecular mass and can flag truncations or modifications that chromatography alone might miss. Amino acid analysis and peptide mapping add sequence-level confirmation, while residual counter-ion and water content are measured separately.
A freeze-dried sample is generally the most stable form and is commonly held at minus twenty degrees Celsius or lower for long-term keeping, with brief transfers at room temperature. The solid is hygroscopic, so vials are warmed to ambient temperature before opening to prevent condensation from degrading the contents. Light exposure and repeated temperature cycling are both avoided in routine handling. Storage over a desiccant is a common laboratory practice that limits moisture uptake during repeated access.
Material of this kind is sold for laboratory research, and labels typically state that it is not intended for human or veterinary use. In many countries it is not an approved medicine, and sports antidoping rules place it among prohibited non-approved substances. Buyers commonly review a certificate of analysis, an independent test report, and the declared storage conditions. Batch-to-batch variation in purity and in counterion content is possible, and how much that variation affects experimental outcomes remains an open question.
Lyophilized peptide is normally kept at minus twenty degrees Celsius or colder, away from light and moisture. Powder held under those conditions is widely treated as stable for long periods, although published stability studies for this exact sequence are sparse and often come from suppliers rather than independent laboratories. Once dissolved, solutions are generally handled cold and used within a short window, because peptide bonds can hydrolyze over time. Repeated freeze-thaw cycles are usually avoided to limit losses, and exact shelf-life figures depend on the buffer and the concentration involved.
Purity is ordinarily reported as a percentage from reverse-phase high-performance liquid chromatography, where the area of the main peak is compared with the total peak area. Identity is confirmed by mass spectrometry, since the measured mass can be checked against the value calculated from the sequence. Some certificates also include amino acid analysis or sequence confirmation by tandem mass spectrometry. A single purity number does not describe the profile of related impurities, so the underlying chromatogram and spectrum usually carry more information than the headline figure.
| Property | Value | Notes |
|---|---|---|
| Dry powder storage | -20 °C or below | Desiccated and protected from light |
| Solution storage | 2-8 °C, short term | Aliquot to avoid freeze-thaw cycling |
| Reconstitution solvent | Water or buffered saline | Near-neutral pH is generally preferred |
| Identity confirmation | Mass spectrometry | Matches expected monoisotopic mass |
| Purity assessment | Reverse-phase HPLC | Reported as main-peak area percentage |
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
BPC-157 is commonly supplied as a lyophilized powder, a freeze-dried solid that is reconstituted before use in laboratory work. As a short peptide, it dissolves readily in water and in aqueous buffer solutions, and stock solutions are typically prepared in water or a mild buffer. The chain contains several proline and acidic residues, which influence how it behaves in solution. Because the solid can take up moisture, weighing and handling are usually performed under low-humidity conditions. Its solubility class is described as freely soluble in water rather than requiring an organic solvent.
Dry powder is generally stored at low temperature, with minus twenty degrees Celsius or colder advised for extended retention. Reconstituted solutions are less stable than the solid form and are normally kept cold and shielded from repeated freeze-thaw cycles. Light exposure is avoided because some peptides degrade under ultraviolet radiation. The exact rate of degradation depends on concentration, pH, and the presence of salts, so a single shelf life does not apply to every preparation. Reported stability figures should be read as indicative of typical handling rather than as universal constants.
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
Human data are far more limited than animal data. A small number of clinical reports exist, generally with few participants and without the randomization or blinding expected in later-phase trials. No large, independently replicated human trial has appeared in the indexed peer-reviewed literature. Statements about effects in people therefore rest on extrapolation from animal work rather than on direct evidence, and the strength of that extrapolation remains an open question rather than a settled matter.
On 14 March, an international group of researchers presented a preliminary analysis at a meeting of the World Health Organization's Scientific Advisory Group for Origins of Novel Pathogens, at which Chinese COVID-19 researchers were also present. On the sixteenth, George Gao, the former head of the CCDC and lead author on the February 2022 preprint, told Science that there was "nothing new" in the raw data, and refused to answer questions about why his research team had removed it from the database. On 17 March, the WHO director-general said that the data should have been shared three years earlier, and called on China to be more transparent in its data-sharing. There exists further data from further samples which has not yet been made public. Maria Van Kerkhove, the WHO's COVID-19 technical lead, called for it to be made public immediately (see Huanan live-animal market#Swabs).
=== Trump administrations === President Donald Trump used the IEEPA extensively, sanctioning more than 3,700 entities and invoking 11 national emergency declarations (out of the 13 that he declared overall) relying primarily or exclusively on IEEPA authority during his 2017–21 term; Trump also used or threatened use of its powers in unconventional and unprecedented manners (including executive actions utilizing powers under the act that prompted legal challenges). On May 30, 2019, the White House announced that Trump would use IEEPA powers to introduce tariffs on imports from Mexico in response to the national security threat of illegal immigration from Mexico into the United States. As part of an ongoing trade war with China, on August 24, 2019, Trump tweeted that he "hereby ordered" U.S. companies to start looking at alternatives to China on the basis of claimed powers under IEEPA. Trump, however, did not formally declare an emergency as required by IEEPA. In September 2020, the Trump administration sanctioned and imposed visa restrictions on two International Criminal Court (ICC) officials, prosecutor Fatou Bensouda and Jurisdiction Complementarity and Cooperation Division Director Phakiso Mochochoko, over the court's investigation into allegations of war crimes committed by the U.S. and Israel in Afghanistan and the Palestinian territories, respectively.
Labial reduction occasionally includes the resection of the clitoral hood when the thickness of its skin interferes with the woman's sexual response or is aesthetically displeasing. The surgical unhooding of the clitoris involves a V–to–Y advancement of the soft tissues, which is achieved by suturing the clitoral hood to the pubic bone in the midline (to avoid the pudendal nerves); thus, uncovering the clitoris further tightens the labia minora.
The two substrates of this enzyme are 4-(hydroxymethyl)benzenesulfonic acid and oxidised nicotinamide adenine dinucleotide (NAD+). Its products are 4-formylbenzenesulfonic acid, reduced NADH, and a proton. This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is 4-(hydroxymethyl)benzenesulfonate:NAD+ oxidoreductase. This enzyme participates in 2,4-dichlorobenzoate degradation.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
He worked on other methods of analytical separation of biological materials, notably electrophoresis and displacement chromatography, but also was influential in developing biochemical engineering within the Chemical Engineering Department at Yale. He published about 300 papers and held 9 patents. He was a member of the United States National Academy of Engineering. He received many other honors and awards and is remembered in the Horváth Laboratory of Separation Science at Innsbruck.
The mandate includes dose assessment for workers who may be exposed to increased radiation exposure and, if necessary, determination of the activity concentration of residues and radioactive substances discharged with the air or waste water.
==== Edwards v. Aguillard ==== Following the McLean ruling, which declared the teaching of "creation science" in public schools to be an unconstitutional establishment of religion, Louisiana's version of the "Equal Time" legislation was put to the test. This time, Wendell Bird was deputized by the state and ran the state's defense of the law. Dean Kenyon was advertised as the creationists' lead expert witness, however the case (which eventually became Edwards v. Aguillard when it reached the Supreme Court) was decided by summary judgment, and so never went to a full trial. Nevertheless, in written briefs and in his oral arguments, Bird relied heavily on an expert witness affidavit written by Kenyon. This affidavit is online at the TalkOrigins website. It was entered into evidence in the Kitzmiller case as evidence that Kenyon was explicitly defending "creation science"—and advocating that it be given equal time in public schools and textbooks as the "only" alternative to evolution—while at the same time working on a public school textbook, which eventually became the first "intelligent design" book, Of Pandas and People. In 1987, in Edwards v. Aguillard the Supreme Court heard a case concerning a Louisiana Law that required "creation science" be taught on an equal basis with evolution in public schools. Anti-creationists argued that this was illegal on the basis that it violated the Establishment Clause of the US Constitution. Kenyon issued an affidavit in that case, stating his support for creationism, and defining it thus:
==== Obsessive–compulsive disorder ==== Clomipramine was the first drug that was investigated for and found to be effective in the treatment of OCD. In addition, it was the first drug to be approved by the FDATooltip Food and Drug Administration in the United States for the treatment of OCD. The effectiveness of clomipramine in the treatment of OCD is far greater than that of other TCAs, which are comparatively weak SRIs; a meta-analysis found pre- versus post-treatment effect sizes of 1.55 for clomipramine relative to a range of 0.67 for imipramine and 0.11 for desipramine. In contrast to other TCAs, studies have found that clomipramine and SSRIs, which are more selective SRIs, have similar effectiveness in the treatment of OCD. However, multiple meta-analyses have found that clomipramine nonetheless retains a significant effectiveness advantage relative to SSRIs; in the same meta-analysis mentioned previously, the effect sizes of SSRIs in the treatment of OCD ranged from 0.81 for fluoxetine to 1.36 for sertraline (relative to 1.55 for clomipramine). In a 2025 meta-analysis of trials in children and adolescents, clomipramine was shown to lower OCD symptoms more than a sugar pill by an average of about 4.5 points on the standard rating scale. However, the effectiveness advantage for clomipramine has not been apparent in head-to-head comparisons of clomipramine versus SSRIs for OCD. The differences in effectiveness findings could be due to differences in methodologies across non-head-to-head studies.
Small-cell carcinoma of the lung usually presents in the central airways and infiltrates the submucosa leading to the narrowing of bronchial airways. Common symptoms include cough, dyspnea, weight loss, and debility. Over 70% of patients with small-cell carcinoma present with metastatic disease; common sites include the liver, adrenals, bone, and brain. Due to its high grade neuroendocrine nature, small-cell carcinomas can produce ectopic hormones, including adrenocorticotropic hormone (ACTH) and anti-diuretic hormone (ADH). Ectopic production of large amounts of ADH leads to syndrome of inappropriate antidiuretic hormone hypersecretion (SIADH). Lambert–Eaton myasthenic syndrome is a well-known paraneoplastic condition linked to small-cell carcinoma. Approximately half of all individuals diagnosed with Lambert–Eaton myasthenic syndrome will eventually be found to have a small-cell carcinoma of the lung.
Sources: en.wikipedia.org
The evidence that arsenic may be a beneficial nutrient at trace levels below the background to which living organisms are normally exposed has been reviewed. Some organoarsenic compounds found in nature are arsenobetaine and arsenocholine, both being found in many marine organisms. Some As-containing nucleosides (sugar derivatives) are also known. Several of these organoarsenic compounds arise via methylation processes. For example, the mold Scopulariopsis brevicaulis produces significant amounts of trimethylarsine if inorganic arsenic is present. The organic compound arsenobetaine is found in some marine foods such as fish and algae, and also in mushrooms in larger concentrations. In clean environments, the edible mushroom species Cyanoboletus pulverulentus hyperaccumulates arsenic compounds in concentrations reaching 1,300 mg/kg (dry weight). A very unusual set of organoarsenic compounds was found in deer truffles (Elaphomyces spp.). The average person's intake is about 10–50 μg/day. Values about 1000 μg are not unusual following consumption of fish or mushrooms; however, there is little danger in eating fish since this arsenic compound is nearly non-toxic.
Some species of algae form symbiotic relationships with other organisms. In these symbioses, the algae supply photosynthates (organic substances) to the host organism providing protection to the algal cells. The host organism derives some or all of its energy requirements from the algae. Examples are:
As a medication, it is used to treat several conditions, including allergic reaction anaphylaxis, cardiac arrest, and superficial bleeding. Inhaled adrenaline may be used to improve the symptoms of croup. It may also be used for asthma when other treatments are not effective. It is given intravenously, by injection into a muscle, by inhalation, or by injection just under the skin. Common side effects include shakiness, anxiety, and sweating. A fast heart rate and high blood pressure may occur. Occasionally it may result in an abnormal heart rhythm. While the safety of its use during pregnancy and breastfeeding is unclear, the benefits to the mother must be taken into account. A case has been made for the use of adrenaline infusion in place of the widely accepted treatment of inotropes for preterm infants with clinical cardiovascular compromise. Although sufficient data strongly recommends adrenaline infusions as a viable treatment, more trials are needed to conclusively determine that these infusions will successfully reduce morbidity and mortality rates among preterm, cardiovascularly compromised infants. Epinephrine can also be used to treat open-angle glaucoma, as it increases the outflow of aqueous humor from the eye, which lowers intraocular pressure.
There are different immune responses that the body could have depending on where the polymer is placed. For example, in drug delivery systems (DDS), PLGA and PLA implants with high surface area and low volume of injection can increase one's chance of immune response as the polymers degrade in the body.
== Treatment == Antivenom therapy is the current standard treatment for snake envenoming. In China, the Bungarus multicinctus monovalent antivenom (BMMAV) is produced and, in Taiwan the Neuro bivalent antivenom (NBAV). Both antivenoms are immunoreactive to the neurotoxins found in the venom, including the α-BTX, which neutralize the venom lethality. BMMAV is specifically designed to neutralize the venom of the Bungarus multicinctus, therefore being more efficacious compared to NBAV. On the other hand, NBAV targets the venom from multiple species of snakes that produce neurotoxic effects, including the Bungarus multicinctus. The use of BMMAV or NBAV might differ based on availability, regional protocols and the specific venomous snake that is present in the area.
Sources: en.wikipedia.org
Low temperature slows the chemical reactions, such as oxidation and hydrolysis, that break down a peptide chain. Water and oxygen are the main drivers of degradation, so a cold and dry environment extends usable life. Actual shelf life depends on the batch, the salt form, and the container.
It normally reports the share of the chromatographic signal that belongs to the main peak, not a measure of activity. A high figure means few related substances were detected under the stated method and wavelength. Different laboratories and methods can return different values for the same material.
Retention time alone is weak evidence, because unrelated peptides can elute at similar positions. Amino acid analysis or peptide mapping gives stronger sequence information when a mass spectrometer is unavailable. Most laboratories still treat mass confirmation as the standard step for verifying the correct compound.
The standard approach is reverse-phase high-performance liquid chromatography, reported as a percentage of total peak area. Because that figure alone says little about the nature of the impurities, the accompanying chromatogram is normally the more useful document for judging a batch.